PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV20625.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family G2-like
Protein Properties Length: 378aa    MW: 41307.6 Da    PI: 8.7148
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV20625.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.4e-32206261156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W++eLH+rFv+a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  KZV20625.1 206 KARRCWSQELHRRFVQALHQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 261
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.038203263IPR017930Myb domain
SuperFamilySSF466895.38E-18204264IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28205264IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-27206261IPR006447Myb domain, plants
PfamPF002496.0E-8208259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MQRVQDYIRR LEEERDKIQV FRRELPLCFE LVTQAIEGYK HQLSGTTTEC NLRGQSECSE  60
QTSRPVLEEF MPLKRASSHS DGEEEDSRKQ NKDLGDISNT DGKNVDEKDS MKSDWLRSVQ  120
LWNQTPDKED SSRKVAEVTE VKRNGGGRCG GAFQPFKKAA TGTSTAPTQV PKNKSPPPAS  180
TSSTADTGGS GGGNKKEEKE GESIRKARRC WSQELHRRFV QALHQLGGSH VATPKQIREL  240
MKVDGLTNDE VKSHLQKYRL HTRRPSPSIQ NNSNSQQTPQ LVVLAGGIWV SPEYAAAMAT  300
TGTSVEASGV ATPPPGIYTP IASVPQPFRE ATASASPRPR QLNSDDRGSR SGEEGGANGS  360
HSPATSSSTH TTTASPFH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070832.11e-156PREDICTED: uncharacterized protein LOC105156412
TrEMBLA0A068TX101e-120A0A068TX10_COFCA; Uncharacterized protein
TrEMBLD7T9871e-120D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-78G2-like family protein